Lineage for d2wdqb2 (2wdq B:107-238)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1718664Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 1718665Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 1718694Protein Succinate dehydogenase [81669] (3 species)
  7. 1718705Species Escherichia coli [TaxId:562] [81670] (5 PDB entries)
  8. 1718706Domain d2wdqb2: 2wdq B:107-238 [198477]
    Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb1, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf1, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj1, d2wdqk_, d2wdql_
    automated match to d1nekb1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqb2

PDB Entry: 2wdq (more details), 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
PDB Compounds: (B:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wdqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdqb2 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
mgqfyaqyekikpyllnngqnpparehlqmpeqrekldglyecilcaccstscpsfwwnp
dkfigpagllaayrflidsrdtetdsrldglsdafsvfrchsimncvsvcpkglnptrai
ghiksmllqrna

SCOPe Domain Coordinates for d2wdqb2:

Click to download the PDB-style file with coordinates for d2wdqb2.
(The format of our PDB-style files is described here.)

Timeline for d2wdqb2: