| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
| Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (1 species) |
| Species Escherichia coli [TaxId:562] [82587] (6 PDB entries) |
| Domain d2wdqb1: 2wdq B:1-106 [198476] Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj2, d2wdqk_, d2wdql_ automated match to d1nekb2 complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo |
PDB Entry: 2wdq (more details), 2.4 Å
SCOPe Domain Sequences for d2wdqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdqb1 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd
Timeline for d2wdqb1: