Lineage for d2wdqb1 (2wdq B:1-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934092Protein Succinate dehydogenase iron-sulfur protein, N-terminal domain [82586] (3 species)
  7. 2934103Species Escherichia coli [TaxId:562] [82587] (6 PDB entries)
  8. 2934111Domain d2wdqb1: 2wdq B:1-106 [198476]
    Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqa3, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqe3, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqi3, d2wdqj2, d2wdqk_, d2wdql_
    automated match to d1nekb2
    complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqb1

PDB Entry: 2wdq (more details), 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
PDB Compounds: (B:) succinate dehydrogenase iron-sulfur subunit

SCOPe Domain Sequences for d2wdqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdqb1 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
mrlefsiyrynpdvddaprmqdytleadegrdmmlldaliqlkekdpslsfrrscregvc
gsdglnmngknglacitpisalnqpgkkivirplpglpvirdlvvd

SCOPe Domain Coordinates for d2wdqb1:

Click to download the PDB-style file with coordinates for d2wdqb1.
(The format of our PDB-style files is described here.)

Timeline for d2wdqb1: