Lineage for d2wdqa3 (2wdq A:451-588)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261318Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1261395Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1261396Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1261433Protein Succinate dehydogenase [81708] (1 species)
  7. 1261434Species Escherichia coli [TaxId:562] [81709] (6 PDB entries)
  8. 1261435Domain d2wdqa3: 2wdq A:451-588 [198475]
    Other proteins in same PDB: d2wdqa1, d2wdqa2, d2wdqb1, d2wdqb2, d2wdqc_, d2wdqd_, d2wdqe1, d2wdqe2, d2wdqf1, d2wdqf2, d2wdqg_, d2wdqh_, d2wdqi1, d2wdqi2, d2wdqj1, d2wdqj2, d2wdqk_, d2wdql_
    automated match to d1neka1
    complexed with cbe, f3s, fad, fes, hem, na, sf4, so4, teo

Details for d2wdqa3

PDB Entry: 2wdq (more details), 2.4 Å

PDB Description: e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound
PDB Compounds: (A:) Succinate dehydrogenase flavoprotein subunit

SCOPe Domain Sequences for d2wdqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wdqa3 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]}
rngedpvairkalqecmqhnfsvfregdamakgleqlkvirerlknarlddtssefntqr
vecleldnlmetayatavsanfrtesrgahsrfdfpdrddenwlchslylpesesmtrrs
vnmepklrpafppkirty

SCOPe Domain Coordinates for d2wdqa3:

Click to download the PDB-style file with coordinates for d2wdqa3.
(The format of our PDB-style files is described here.)

Timeline for d2wdqa3: