Lineage for d2fb4h1 (2fb4 H:1-119)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219835Species Fab KOL (human), lambda L chain [48767] (2 PDB entries)
  8. 219836Domain d2fb4h1: 2fb4 H:1-119 [19847]
    Other proteins in same PDB: d2fb4h2, d2fb4l2

Details for d2fb4h1

PDB Entry: 2fb4 (more details), 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

SCOP Domain Sequences for d2fb4h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain}
evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
pvtvssa

SCOP Domain Coordinates for d2fb4h1:

Click to download the PDB-style file with coordinates for d2fb4h1.
(The format of our PDB-style files is described here.)

Timeline for d2fb4h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fb4h2