Lineage for d2w0lc_ (2w0l C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290033Species Human (Homo sapiens) [TaxId:9606] [188740] (75 PDB entries)
  8. 1290129Domain d2w0lc_: 2w0l C: [198468]
    automated match to d2w0ld_
    mutant

Details for d2w0lc_

PDB Entry: 2w0l (more details), 2.2 Å

PDB Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2
PDB Compounds: (C:) v1-22 protein

SCOPe Domain Sequences for d2w0lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0lc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

SCOPe Domain Coordinates for d2w0lc_:

Click to download the PDB-style file with coordinates for d2w0lc_.
(The format of our PDB-style files is described here.)

Timeline for d2w0lc_: