SCOP 1.55: Domain d2fb4l1: 2fb4 L:1-109

Lineage for d2fb4l1 (2fb4 L:1-109)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab KOL (human), lambda L chain [48767] (2 PDB entries)

8. Domain d2fb4l1: 2fb4 L:1-109 [19846]
   Other proteins in same PDB: d2fb4h2, d2fb4l2

Details for d2fb4l1

PDB Entry: 2fb4, 1.9 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda-typ, subgruppe i (german)

SCOP Domain Sequences for d2fb4l1:

Sequence; same for both SEQRES and ATOM records:

>d2fb4l1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain}
qsvltqppsasgtpgqrvtiscsgtssnigsstvnwyqqlpgmapklliyrdamrpsgvp
drfsgsksgasaslaigglqsedetdyycaawdvslnayvfgtgtkvtvlg

Timeline for d2fb4l1:

• d2fb4l1 appears in SCOP 1.57
  
• d2fb4l1 appears in the current release, SCOPe 2.08