Lineage for d2vlmd2 (2vlm D:113-201)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517370Domain d2vlmd2: 2vlm D:113-201 [198451]
    Other proteins in same PDB: d2vlmd1, d2vlme1, d2vlme2
    automated match to d1qrnd2

Details for d2vlmd2

PDB Entry: 2vlm (more details), 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (D:) jm22 tcr alpha chain

SCOPe Domain Sequences for d2vlmd2:

Sequence, based on SEQRES records: (download)

>d2vlmd2 b.1.1.2 (D:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d2vlmd2 b.1.1.2 (D:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvkdsdvyitdsnsavawsnksdfacana
fnnsiipedtffps

SCOPe Domain Coordinates for d2vlmd2:

Click to download the PDB-style file with coordinates for d2vlmd2.
(The format of our PDB-style files is described here.)

Timeline for d2vlmd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vlmd1