SCOPe 2.08: Domain d2vlmd2: 2vlm D:113-201

Lineage for d2vlmd2 (2vlm D:113-201)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d2vlmd2: 2vlm D:113-201 [198451]
   Other proteins in same PDB: d2vlmd1, d2vlme1, d2vlme2
   automated match to d1qrnd2

Details for d2vlmd2

PDB Entry: 2vlm, 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (D:) jm22 tcr alpha chain

SCOPe Domain Sequences for d2vlmd2:

Sequence, based on SEQRES records:

>d2vlmd2 b.1.1.2 (D:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d2vlmd2 b.1.1.2 (D:113-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvkdsdvyitdsnsavawsnksdfacana
fnnsiipedtffps

Timeline for d2vlmd2:

• d2vlmd2 first appeared in SCOPe 2.03
  
• d2vlmd2 appears in SCOPe 2.07