SCOPe 2.03: Domain d2vlmd1: 2vlm D:3-112

Lineage for d2vlmd1 (2vlm D:3-112)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d2vlmd1: 2vlm D:3-112 [198450]
   Other proteins in same PDB: d2vlmd2, d2vlme1, d2vlme2
   automated match to d1qrnd1

Details for d2vlmd1

PDB Entry: 2vlm, 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (D:) jm22 tcr alpha chain

SCOPe Domain Sequences for d2vlmd1:

Sequence; same for both SEQRES and ATOM records:

>d2vlmd1 b.1.1.0 (D:3-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qlleqspqflsiqegenltvycnsssvfsslqwyrqepgegpvllvtvvtggevkklkrl
tfqfgdarkdsslhitaaqpgdtglylcagagsqgnlifgkgtklsvkpn

Timeline for d2vlmd1:

• d2vlmd1 is new in SCOPe 2.03-stable
  
• d2vlmd1 appears in SCOPe 2.04
  
• d2vlmd1 appears in the current release, SCOPe 2.08