![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
![]() | Domain d2vl5d2: 2vl5 D:112-216 [198449] Other proteins in same PDB: d2vl5a1, d2vl5b1, d2vl5c1, d2vl5d1 automated match to d1dqdl2 |
PDB Entry: 2vl5 (more details), 2.1 Å
SCOPe Domain Sequences for d2vl5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl5d2 b.1.1.2 (D:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d2vl5d2:
![]() Domains from other chains: (mouse over for more information) d2vl5a1, d2vl5b1, d2vl5b2, d2vl5c1 |