SCOPe 2.05: Domain d2vl5d2: 2vl5 D:112-216

Lineage for d2vl5d2 (2vl5 D:112-216)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d2vl5d2: 2vl5 D:112-216 [198449]
   Other proteins in same PDB: d2vl5a1, d2vl5b1, d2vl5c1, d2vl5d1
   automated match to d1dqdl2

Details for d2vl5d2

PDB Entry: 2vl5, 2.1 Å

PDB Description: structure of anti-collagen type ii fab ciic1

PDB Compounds: (D:) ciic1 anticollagen fab

SCOPe Domain Sequences for d2vl5d2:

Sequence; same for both SEQRES and ATOM records:

>d2vl5d2 b.1.1.2 (D:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2vl5d2:

• d2vl5d2 first appeared in SCOPe 2.03
  
• d2vl5d2 appears in SCOPe 2.04
  
• d2vl5d2 appears in SCOPe 2.06
  
• d2vl5d2 appears in the current release, SCOPe 2.08