SCOPe 2.08: Domain d2vl5d2: 2vl5 D:112-216

Lineage for d2vl5d2 (2vl5 D:112-216)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d2vl5d2: 2vl5 D:112-216 [198449]
Other proteins in same PDB: d2vl5a1, d2vl5a2, d2vl5b1, d2vl5c1, d2vl5c2, d2vl5d1
automated match to d1dqdl2

Details for d2vl5d2

PDB Entry: 2vl5 (more details), 2.1 Å

PDB Description: structure of anti-collagen type ii fab ciic1

PDB Compounds: (D:) ciic1 anticollagen fab

SCOPe Domain Sequences for d2vl5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vl5d2 b.1.1.2 (D:112-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d2vl5d2:

Click to download the PDB-style file with coordinates for d2vl5d2.
(The format of our PDB-style files is described here.)

Timeline for d2vl5d2: