SCOPe 2.06: Domain d2vl5d1: 2vl5 D:1-111

Lineage for d2vl5d1 (2vl5 D:1-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d2vl5d1: 2vl5 D:1-111 [198448]
   Other proteins in same PDB: d2vl5a1, d2vl5b2, d2vl5c1, d2vl5d2
   automated match to d1dqdl1

Details for d2vl5d1

PDB Entry: 2vl5, 2.1 Å

PDB Description: structure of anti-collagen type ii fab ciic1

PDB Compounds: (D:) ciic1 anticollagen fab

SCOPe Domain Sequences for d2vl5d1:

Sequence; same for both SEQRES and ATOM records:

>d2vl5d1 b.1.1.0 (D:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspasltvslgqratiscrasksvdsygnsfmewyqqkpgqppklliyrasnles
giparfsgsgsrtdftltinpveaddvatyycqqsnedpytfgggtkleik

Timeline for d2vl5d1:

• d2vl5d1 first appeared in SCOPe 2.03
  
• d2vl5d1 appears in SCOPe 2.05
  
• d2vl5d1 appears in SCOPe 2.07
  
• d2vl5d1 appears in the current release, SCOPe 2.08