Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab R19.9 (mouse), kappa L chain [48766] (2 PDB entries) |
Domain d2f19h1: 2f19 H:1-123 [19843] Other proteins in same PDB: d2f19h2, d2f19l2 |
PDB Entry: 2f19 (more details), 2.8 Å
SCOP Domain Sequences for d2f19h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f19h1 b.1.1.1 (H:1-123) Immunoglobulin (variable domains of L and H chains) {Fab R19.9 (mouse), kappa L chain} qvqlqqsgaelvragssvkmsckasgytftsygvnwvkqrpgqglewigyinpgkgylsy nekfkgkttltvdrssstaymqlrsltsedaavyfcarsfyggsdlavyyfdswgqgttl tvs
Timeline for d2f19h1: