Lineage for d2vdid1 (2vdi D:11-150)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2559905Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 2559957Domain d2vdid1: 2vdi D:11-150 [198419]
    Other proteins in same PDB: d2vdia2, d2vdib2, d2vdic2, d2vdid2, d2vdie2, d2vdif2, d2vdig2, d2vdih2, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_
    automated match to d1wdda2
    complexed with cap, edo, mg; mutant

Details for d2vdid1

PDB Entry: 2vdi (more details), 2.65 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit c192s mutation
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdid1 d.58.9.0 (D:11-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfvg

SCOPe Domain Coordinates for d2vdid1:

Click to download the PDB-style file with coordinates for d2vdid1.
(The format of our PDB-style files is described here.)

Timeline for d2vdid1: