Lineage for d2vdib1 (2vdi B:8-150)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909408Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 1909466Domain d2vdib1: 2vdi B:8-150 [198415]
    Other proteins in same PDB: d2vdia2, d2vdib2, d2vdic2, d2vdid2, d2vdie2, d2vdif2, d2vdig2, d2vdih2, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_
    automated match to d1wdda2
    complexed with cap, edo, mg; mutant

Details for d2vdib1

PDB Entry: 2vdi (more details), 2.65 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit c192s mutation
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdib1 d.58.9.0 (B:8-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt
tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf
kalralrledlrippayvktfvg

SCOPe Domain Coordinates for d2vdib1:

Click to download the PDB-style file with coordinates for d2vdib1.
(The format of our PDB-style files is described here.)

Timeline for d2vdib1: