Lineage for d2vdia2 (2vdi A:151-475)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1344774Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1344775Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1345026Protein automated matches [226984] (4 species)
    not a true protein
  7. 1345027Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (2 PDB entries)
  8. 1345036Domain d2vdia2: 2vdi A:151-475 [198414]
    Other proteins in same PDB: d2vdia1, d2vdib1, d2vdic1, d2vdid1, d2vdie1, d2vdif1, d2vdig1, d2vdih1, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_
    automated match to d1wdda1
    complexed with cap, edo, mg; mutant

Details for d2vdia2

PDB Entry: 2vdi (more details), 2.65 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit c192s mutation
PDB Compounds: (A:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdia2 c.1.14.1 (A:151-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
pphgiqverdklnkygrgllgctikpklglsaknygravyeslrggldftkddenvnsqp
fmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdyl
tggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsgt
vvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpal
veifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsack
wspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d2vdia2:

Click to download the PDB-style file with coordinates for d2vdia2.
(The format of our PDB-style files is described here.)

Timeline for d2vdia2: