Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) automatically mapped to Pfam PF00016 |
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
Protein automated matches [226984] (4 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (2 PDB entries) |
Domain d2vdia2: 2vdi A:151-475 [198414] Other proteins in same PDB: d2vdia1, d2vdib1, d2vdic1, d2vdid1, d2vdie1, d2vdif1, d2vdig1, d2vdih1, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_ automated match to d1wdda1 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdi (more details), 2.65 Å
SCOPe Domain Sequences for d2vdia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdia2 c.1.14.1 (A:151-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} pphgiqverdklnkygrgllgctikpklglsaknygravyeslrggldftkddenvnsqp fmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdyl tggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsgt vvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpal veifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsack wspelaaacevwkeikfefdtidkl
Timeline for d2vdia2: