![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
![]() | Domain d2vdia1: 2vdi A:11-150 [198413] Other proteins in same PDB: d2vdia2, d2vdib2, d2vdic2, d2vdid2, d2vdie2, d2vdif2, d2vdig2, d2vdih2, d2vdii_, d2vdij_, d2vdik_, d2vdil_, d2vdim_, d2vdin_, d2vdio_, d2vdip_ automated match to d1wdda2 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdi (more details), 2.65 Å
SCOPe Domain Sequences for d2vdia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdia1 d.58.9.0 (A:11-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfvg
Timeline for d2vdia1: