Lineage for d1ineh1 (1ine H:1-114)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1287992Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (58 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 1288031Domain d1ineh1: 1ine H:1-114 [19841]
    Other proteins in same PDB: d1ineh2, d1inel1, d1inel2
    part of Fab Cha255
    complexed with eot, fe

Details for d1ineh1

PDB Entry: 1ine (more details), 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
PDB Compounds: (H:) igg1-lambda cha255 fab (heavy chain)

SCOPe Domain Sequences for d1ineh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ineh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsa

SCOPe Domain Coordinates for d1ineh1:

Click to download the PDB-style file with coordinates for d1ineh1.
(The format of our PDB-style files is described here.)

Timeline for d1ineh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ineh2