Lineage for d2vdhd1 (2vdh D:11-150)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909408Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 1909444Domain d2vdhd1: 2vdh D:11-150 [198403]
    Other proteins in same PDB: d2vdha2, d2vdhb2, d2vdhc2, d2vdhd2, d2vdhe2, d2vdhf2, d2vdhg2, d2vdhh2, d2vdhi_, d2vdhj_, d2vdhk_, d2vdhl_, d2vdhm_, d2vdhn_, d2vdho_, d2vdhp_
    automated match to d1wdda2
    complexed with cap, edo, mg; mutant

Details for d2vdhd1

PDB Entry: 2vdh (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdhd1 d.58.9.0 (D:11-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
ralrledlrippayvktfvg

SCOPe Domain Coordinates for d2vdhd1:

Click to download the PDB-style file with coordinates for d2vdhd1.
(The format of our PDB-style files is described here.)

Timeline for d2vdhd1: