![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (16 species) not a true protein |
![]() | Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225548] (9 PDB entries) |
![]() | Domain d2vdhb2: 2vdh B:151-475 [198400] Other proteins in same PDB: d2vdha1, d2vdhb1, d2vdhc1, d2vdhd1, d2vdhe1, d2vdhf1, d2vdhg1, d2vdhh1, d2vdhi_, d2vdhj_, d2vdhk_, d2vdhl_, d2vdhm_, d2vdhn_, d2vdho_, d2vdhp_ automated match to d1wdda1 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdh (more details), 2.3 Å
SCOPe Domain Sequences for d2vdhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdhb2 c.1.14.1 (B:151-475) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} pphgiqverdklnkygrgllgstikpklglsaknygravyeclrggldftkddenvnsqp fmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdyl tggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsgt vvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpal veifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsack wspelaaacevwkeikfefdtidkl
Timeline for d2vdhb2: