![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species) VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88541] (35 PDB entries) |
![]() | Domain d1inel1: 1ine L:2-109 [19840] Other proteins in same PDB: d1ineh1, d1ineh2, d1inel2 part of Fab Cha255 complexed with eot, fe |
PDB Entry: 1ine (more details), 2.8 Å
SCOPe Domain Sequences for d1inel1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1inel1 b.1.1.1 (L:2-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]} avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl
Timeline for d1inel1: