Lineage for d1inel1 (1ine L:2-109)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102565Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries)
  8. 102569Domain d1inel1: 1ine L:2-109 [19840]
    Other proteins in same PDB: d1ineh2, d1inel2

Details for d1inel1

PDB Entry: 1ine (more details), 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1inel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inel1 b.1.1.1 (L:2-109) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl

SCOP Domain Coordinates for d1inel1:

Click to download the PDB-style file with coordinates for d1inel1.
(The format of our PDB-style files is described here.)

Timeline for d1inel1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inel2