Lineage for d1inel1 (1ine L:2-109)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2741614Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. 2741706Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. 2741751Domain d1inel1: 1ine L:2-109 [19840]
    Other proteins in same PDB: d1ineh1, d1ineh2, d1inel2
    part of Fab Cha255
    complexed with eot, fe

Details for d1inel1

PDB Entry: 1ine (more details), 2.8 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
PDB Compounds: (L:) igg1-lambda cha255 fab (light chain)

SCOPe Domain Sequences for d1inel1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1inel1 b.1.1.1 (L:2-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl

SCOPe Domain Coordinates for d1inel1:

Click to download the PDB-style file with coordinates for d1inel1.
(The format of our PDB-style files is described here.)

Timeline for d1inel1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1inel2