| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (12 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
| Domain d2vdhb1: 2vdh B:8-150 [198399] Other proteins in same PDB: d2vdha2, d2vdhb2, d2vdhc2, d2vdhd2, d2vdhe2, d2vdhf2, d2vdhg2, d2vdhh2, d2vdhi_, d2vdhj_, d2vdhk_, d2vdhl_, d2vdhm_, d2vdhn_, d2vdho_, d2vdhp_ automated match to d1wdda2 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdh (more details), 2.3 Å
SCOPe Domain Sequences for d2vdhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdhb1 d.58.9.0 (B:8-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt
tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf
kalralrledlrippayvktfvg
Timeline for d2vdhb1: