Lineage for d2vdhb1 (2vdh B:8-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953040Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 2953066Domain d2vdhb1: 2vdh B:8-150 [198399]
    Other proteins in same PDB: d2vdha2, d2vdhb2, d2vdhc2, d2vdhd2, d2vdhe2, d2vdhf2, d2vdhg2, d2vdhh2, d2vdhi_, d2vdhj_, d2vdhk_, d2vdhl_, d2vdhm_, d2vdhn_, d2vdho_, d2vdhp_
    automated match to d1wdda2
    complexed with cap, edo, mg; mutant

Details for d2vdhb1

PDB Entry: 2vdh (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2vdhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdhb1 d.58.9.0 (B:8-150) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt
tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf
kalralrledlrippayvktfvg

SCOPe Domain Coordinates for d2vdhb1:

Click to download the PDB-style file with coordinates for d2vdhb1.
(The format of our PDB-style files is described here.)

Timeline for d2vdhb1: