Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries) Uniprot P00829 |
Domain d2v7qe3: 2v7q E:358-474 [198393] Other proteins in same PDB: d2v7qd1, d2v7qd2, d2v7qe1, d2v7qe2, d2v7qf1, d2v7qf2, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj1 automated match to d1w0jd1 complexed with adp, atp, mg, po4 |
PDB Entry: 2v7q (more details), 2.1 Å
SCOPe Domain Sequences for d2v7qe3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v7qe3 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla
Timeline for d2v7qe3: