SCOPe 2.05: Domain d2v7qe1: 2v7q E:10-81

Lineage for d2v7qe1 (2v7q E:10-81)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
   Uniprot P00829

8. Domain d2v7qe1: 2v7q E:10-81 [198391]
   Other proteins in same PDB: d2v7qa1, d2v7qa2, d2v7qa3, d2v7qb1, d2v7qb2, d2v7qb3, d2v7qc1, d2v7qc2, d2v7qc3, d2v7qd2, d2v7qd3, d2v7qe2, d2v7qe3, d2v7qf2, d2v7qf3, d2v7qg_, d2v7qh1, d2v7qh2, d2v7qi_, d2v7qj_
   automated match to d1w0jd2
   complexed with adp, atp, mg, po4

Details for d2v7qe1

PDB Entry: 2v7q, 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.

PDB Compounds: (E:) ATP synthase subunit beta

SCOPe Domain Sequences for d2v7qe1:

Sequence; same for both SEQRES and ATOM records:

>d2v7qe1 b.49.1.1 (E:10-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
tgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgtegl
vrgqkvldsgap

Timeline for d2v7qe1:

• d2v7qe1 first appeared in SCOPe 2.03
  
• d2v7qe1 appears in SCOPe 2.04
  
• d2v7qe1 appears in SCOPe 2.06
  
• d2v7qe1 appears in the current release, SCOPe 2.08