Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries) |
Domain d1indh1: 1ind H:1-114 [19839] Other proteins in same PDB: d1indh2, d1indl2 complexed with eot, in |
PDB Entry: 1ind (more details), 2.2 Å
SCOP Domain Sequences for d1indh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain} evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsa
Timeline for d1indh1: