Lineage for d1indh1 (1ind H:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7544Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries)
  8. 7545Domain d1indh1: 1ind H:1-114 [19839]
    Other proteins in same PDB: d1indh2, d1indl2

Details for d1indh1

PDB Entry: 1ind (more details), 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1indh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsa

SCOP Domain Coordinates for d1indh1:

Click to download the PDB-style file with coordinates for d1indh1.
(The format of our PDB-style files is described here.)

Timeline for d1indh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1indh2