Lineage for d2v4ob1 (2v4o B:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919320Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 2919321Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 2919337Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 2919338Protein automated matches [190619] (7 species)
    not a true protein
  7. 2919357Species Salmonella typhimurium [TaxId:99287] [196119] (10 PDB entries)
  8. 2919378Domain d2v4ob1: 2v4o B:1-253 [198382]
    Other proteins in same PDB: d2v4oa2, d2v4ob2, d2v4oc2, d2v4od2
    automated match to d2v4od_
    complexed with gol, mg, po4

Details for d2v4ob1

PDB Entry: 2v4o (more details), 2.71 Å

PDB Description: crystal structure of salmonella typhimurium sure at 2.75 angstrom resolution in monoclinic form
PDB Compounds: (B:) multifunctional protein sur e

SCOPe Domain Sequences for d2v4ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4ob1 c.106.1.0 (B:1-253) automated matches {Salmonella typhimurium [TaxId: 99287]}
mrillsnddgvhapgiqtlakalrefadvqvvapdrnrsgasnsltlesslrtftfdngd
iavqmgtptdcvylgvnalmrprpdivvsginagpnlgddviysgtvaaamegrhlgfpa
lavslngyqhydtaaavtcallrglsreplrtgrilnvnvpdlplaqvkgirvtrcgsrh
padkvipqedprgntlywigppgdkydagpdtdfaavdegyvsvtplhvdltahsahdvv
sdwldsvgvgtqw

SCOPe Domain Coordinates for d2v4ob1:

Click to download the PDB-style file with coordinates for d2v4ob1.
(The format of our PDB-style files is described here.)

Timeline for d2v4ob1: