SCOP 1.75: Domain d1indl1: 1ind L:2-109

Lineage for d1indl1 (1ind L:2-109)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
   VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family

7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (34 PDB entries)

8. Domain d1indl1: 1ind L:2-109 [19838]
   Other proteins in same PDB: d1indh1, d1indh2, d1indl2
   part of Fab Cha255
   complexed with eot, in

Details for d1indl1

PDB Entry: 1ind, 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

PDB Compounds: (L:) igg1-lambda cha255 fab (light chain)

SCOP Domain Sequences for d1indl1:

Sequence; same for both SEQRES and ATOM records:

>d1indl1 b.1.1.1 (L:2-109) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl

Timeline for d1indl1:

• d1indl1 first appeared (with stable ids) in SCOP 1.55
  
• d1indl1 appears in SCOP 1.73
  
• d1indl1 appears in SCOPe 2.01
  
• d1indl1 appears in the current release, SCOPe 2.08