SCOP 1.63: Domain d1indl1: 1ind L:2-109

Lineage for d1indl1 (1ind L:2-109)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries)

8. Domain d1indl1: 1ind L:2-109 [19838]
   Other proteins in same PDB: d1indh2, d1indl2

Details for d1indl1

PDB Entry: 1ind, 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1indl1:

Sequence; same for both SEQRES and ATOM records:

>d1indl1 b.1.1.1 (L:2-109) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl

Timeline for d1indl1:

• d1indl1 first appeared (with stable ids) in SCOP 1.55
  
• d1indl1 appears in SCOP 1.61
  
• d1indl1 appears in SCOP 1.65
  
• d1indl1 appears in the current release, SCOPe 2.08