Lineage for d1indl1 (1ind L:2-109)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219607Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries)
  8. 219609Domain d1indl1: 1ind L:2-109 [19838]
    Other proteins in same PDB: d1indh2, d1indl2

Details for d1indl1

PDB Entry: 1ind (more details), 2.2 Å

PDB Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate

SCOP Domain Sequences for d1indl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1indl1 b.1.1.1 (L:2-109) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain}
avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl

SCOP Domain Coordinates for d1indl1:

Click to download the PDB-style file with coordinates for d1indl1.
(The format of our PDB-style files is described here.)

Timeline for d1indl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1indl2