Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab Cha255 (mouse), lambda L chain [48765] (2 PDB entries) |
Domain d1indl1: 1ind L:2-109 [19838] Other proteins in same PDB: d1indh2, d1indl2 |
PDB Entry: 1ind (more details), 2.2 Å
SCOP Domain Sequences for d1indl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1indl1 b.1.1.1 (L:2-109) Immunoglobulin (variable domains of L and H chains) {Fab Cha255 (mouse), lambda L chain} avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvl
Timeline for d1indl1: