Lineage for d2uylx1 (2uyl X:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758513Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries)
  8. 1758644Domain d2uylx1: 2uyl X:1-112 [198376]
    Other proteins in same PDB: d2uyla2, d2uylb1, d2uylm2, d2uyln1, d2uylv2, d2uylw1, d2uylx2, d2uyly1
    automated match to d1blna1

Details for d2uylx1

PDB Entry: 2uyl (more details), 2.5 Å

PDB Description: Crystal structure of a monoclonal antibody directed against an antigenic determinant common to Ogawa and Inaba serotypes of Vibrio cholerae O1
PDB Compounds: (X:) monoclonal antibody f-22-30

SCOPe Domain Sequences for d2uylx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uylx1 b.1.1.1 (X:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleik

SCOPe Domain Coordinates for d2uylx1:

Click to download the PDB-style file with coordinates for d2uylx1.
(The format of our PDB-style files is described here.)

Timeline for d2uylx1: