Lineage for d2uylm1 (2uyl M:1-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290351Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
  8. 1290463Domain d2uylm1: 2uyl M:1-112 [198372]
    Other proteins in same PDB: d2uyla2, d2uylb1, d2uylm2, d2uyln1, d2uylv2, d2uylw1, d2uylx2, d2uyly1
    automated match to d1blna1

Details for d2uylm1

PDB Entry: 2uyl (more details), 2.5 Å

PDB Description: Crystal structure of a monoclonal antibody directed against an antigenic determinant common to Ogawa and Inaba serotypes of Vibrio cholerae O1
PDB Compounds: (M:) monoclonal antibody f-22-30

SCOPe Domain Sequences for d2uylm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uylm1 b.1.1.1 (M:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleik

SCOPe Domain Coordinates for d2uylm1:

Click to download the PDB-style file with coordinates for d2uylm1.
(The format of our PDB-style files is described here.)

Timeline for d2uylm1: