Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries) |
Domain d2uyla1: 2uyl A:1-112 [198370] Other proteins in same PDB: d2uyla2, d2uylb1, d2uylm2, d2uyln1, d2uylv2, d2uylw1, d2uylx2, d2uyly1 automated match to d1blna1 |
PDB Entry: 2uyl (more details), 2.5 Å
SCOPe Domain Sequences for d2uyla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uyla1 b.1.1.1 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} elvmtqtppslpvslgdqasiscrssqsivhsngdtylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftleisrveaedlgvyycfqgshvprtfgggtkleik
Timeline for d2uyla1: