Lineage for d1qlrd1 (1qlr D:1-120)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546661Species Human (Homo sapiens), cluster 2.1 [TaxId:9606] [88545] (3 PDB entries)
  8. 546666Domain d1qlrd1: 1qlr D:1-120 [19837]
    Other proteins in same PDB: d1qlra1, d1qlra2, d1qlrb2, d1qlrc1, d1qlrc2, d1qlrd2
    part of Fab Kau cold agglutinin IgM
    complexed with fuc, nag

Details for d1qlrd1

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

SCOP Domain Sequences for d1qlrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlrd1 b.1.1.1 (D:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

SCOP Domain Coordinates for d1qlrd1:

Click to download the PDB-style file with coordinates for d1qlrd1.
(The format of our PDB-style files is described here.)

Timeline for d1qlrd1: