Lineage for d1qlrd1 (1qlr D:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52422Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries)
  8. 52430Domain d1qlrd1: 1qlr D:1-120 [19837]
    Other proteins in same PDB: d1qlra2, d1qlrb2, d1qlrc2, d1qlrd2

Details for d1qlrd1

PDB Entry: 1qlr (more details), 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

SCOP Domain Sequences for d1qlrd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlrd1 b.1.1.1 (D:1-120) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
evqlqqwgagllkpsetlsltcavyggsfsdyywswirqppgkglewigeinhsgstnyn
pslksrvtisvdtsknqfslklssvtaadtavyycarpphdtsghywnywgqgtlvtvss

SCOP Domain Coordinates for d1qlrd1:

Click to download the PDB-style file with coordinates for d1qlrd1.
(The format of our PDB-style files is described here.)

Timeline for d1qlrd1: