Lineage for d2uxlh2 (2uxl H:36-251)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1316165Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1316166Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 1316167Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 1316168Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1316169Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
    Uniprot P11846
  8. 1316229Domain d2uxlh2: 2uxl H:36-251 [198367]
    Other proteins in same PDB: d2uxlh1, d2uxll_, d2uxlm_
    automated match to d1l9bh1
    complexed with bcl, bph, fe, gol, hto, lda, spo, u10, uq2

Details for d2uxlh2

PDB Entry: 2uxl (more details), 2.88 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 10 in the neutral state, 2nd dataset
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2uxlh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxlh2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

SCOPe Domain Coordinates for d2uxlh2:

Click to download the PDB-style file with coordinates for d2uxlh2.
(The format of our PDB-style files is described here.)

Timeline for d2uxlh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uxlh1