![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins) |
![]() | Protein Photosynthetic reaction centre [50348] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries) Uniprot P11846 |
![]() | Domain d2uxlh2: 2uxl H:36-251 [198367] Other proteins in same PDB: d2uxlh1, d2uxll_, d2uxlm_ automated match to d1l9bh1 complexed with bcl, bph, fe, gol, hto, lda, spo, u10, uq2 |
PDB Entry: 2uxl (more details), 2.88 Å
SCOPe Domain Sequences for d2uxlh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uxlh2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrksv
Timeline for d2uxlh2: