SCOPe 2.08: Domain d2uxlh2: 2uxl H:36-251

Lineage for d2uxlh2 (2uxl H:36-251)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d2uxlh2: 2uxl H:36-251 [198367]
   Other proteins in same PDB: d2uxlh1, d2uxll_, d2uxlm_
   automated match to d1l9bh1
   complexed with bcl, bph, fe, gol, hto, lda, spo, u10, uq2

Details for d2uxlh2

PDB Entry: 2uxl, 2.88 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 10 in the neutral state, 2nd dataset

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2uxlh2:

Sequence; same for both SEQRES and ATOM records:

>d2uxlh2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

Timeline for d2uxlh2:

• d2uxlh2 first appeared in SCOPe 2.03
  
• d2uxlh2 appears in SCOPe 2.07