Lineage for d2uxjh2 (2uxj H:36-251)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401018Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2401019Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2401020Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)
  6. 2401021Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2401022Species Rhodobacter sphaeroides [TaxId:1063] [50350] (87 PDB entries)
    Uniprot P11846
  8. 2401040Domain d2uxjh2: 2uxj H:36-251 [198363]
    Other proteins in same PDB: d2uxjh1, d2uxjl_, d2uxjm_
    automated match to d1l9bh1
    complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2uxjh2

PDB Entry: 2uxj (more details), 2.25 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 10 in the neutral state
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2uxjh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxjh2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

SCOPe Domain Coordinates for d2uxjh2:

Click to download the PDB-style file with coordinates for d2uxjh2.
(The format of our PDB-style files is described here.)

Timeline for d2uxjh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uxjh1