SCOPe 2.05: Domain d2ux5h2: 2ux5 H:36-251

Lineage for d2ux5h2 (2ux5 H:36-251)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (83 PDB entries)
   Uniprot P11846

8. Domain d2ux5h2: 2ux5 H:36-251 [198361]
   Other proteins in same PDB: d2ux5h1, d2ux5l_, d2ux5m_
   automated match to d1l9bh1
   complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2ux5h2

PDB Entry: 2ux5, 2.21 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 9 in the charge-separated state

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2ux5h2:

Sequence; same for both SEQRES and ATOM records:

>d2ux5h2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

Timeline for d2ux5h2:

• d2ux5h2 first appeared in SCOPe 2.03
  
• d2ux5h2 appears in SCOPe 2.04
  
• d2ux5h2 appears in SCOPe 2.06
  
• d2ux5h2 appears in the current release, SCOPe 2.08