SCOPe 2.08: Domain d1qlrc1: 1qlr C:1-107

Lineage for d1qlrc1 (1qlr C:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)

8. Domain d1qlrc1: 1qlr C:1-107 [19836]
   Other proteins in same PDB: d1qlra2, d1qlrb1, d1qlrb2, d1qlrc2, d1qlrd1, d1qlrd2
   part of Fab Kau cold agglutinin IgM

Details for d1qlrc1

PDB Entry: 1qlr, 2.83 Å

PDB Description: crystal structure of the fab fragment of a human monoclonal igm cold agglutinin

PDB Compounds: (C:) igm kappa chain v-III (kau cold agglutinin)

SCOPe Domain Sequences for d1qlrc1:

Sequence; same for both SEQRES and ATOM records:

>d1qlrc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveik

Timeline for d1qlrc1:

• d1qlrc1 first appeared (with stable ids) in SCOP 1.55
  
• d1qlrc1 appears in SCOPe 2.07