SCOPe 2.08: Domain d2ux4h2: 2ux4 H:36-251

Lineage for d2ux4h2 (2ux4 H:36-251)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (88 PDB entries)
   Uniprot P11846

8. Domain d2ux4h2: 2ux4 H:36-251 [198359]
   Other proteins in same PDB: d2ux4h1, d2ux4l_, d2ux4m_
   automated match to d1l9bh1
   complexed with bcl, bph, cdl, fe, gol, hto, lda, po4, spo, u10, uq2

Details for d2ux4h2

PDB Entry: 2ux4, 2.51 Å

PDB Description: x-ray high resolution structure of the photosynthetic reaction center from rb. sphaeroides at ph 9 in the charge-separated state, 2nd dataset

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2ux4h2:

Sequence; same for both SEQRES and ATOM records:

>d2ux4h2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

Timeline for d2ux4h2:

• d2ux4h2 first appeared in SCOPe 2.03
  
• d2ux4h2 appears in SCOPe 2.07