Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48764] (2 PDB entries) |
Domain d1qlra1: 1qlr A:1-107 [19834] Other proteins in same PDB: d1qlra2, d1qlrb2, d1qlrc2, d1qlrd2 |
PDB Entry: 1qlr (more details), 2.83 Å
SCOP Domain Sequences for d1qlra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlra1 b.1.1.1 (A:1-107) Immunoglobulin (variable domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain} eivltqspatlslspgeratlscgasqsvssnylawyqqkpgqaprlliydassratgip drfsgsgsgtdftltisrlepedfavyycqqygsspltfgggtkveik
Timeline for d1qlra1: