Lineage for d2remb_ (2rem B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880569Species Xylella fastidiosa [TaxId:2371] [196083] (2 PDB entries)
  8. 2880572Domain d2remb_: 2rem B: [198338]
    automated match to d2remc_

Details for d2remb_

PDB Entry: 2rem (more details), 1.9 Å

PDB Description: crystal structure of oxidoreductase dsba from xylella fastidiosa
PDB Compounds: (B:) Disulfide oxidoreductase

SCOPe Domain Sequences for d2remb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2remb_ c.47.1.0 (B:) automated matches {Xylella fastidiosa [TaxId: 2371]}
hlpvvgedyveipdgrpfaplagkievveifgytcphcahfdsklqawgarqakdvrftl
vpavfggvwdpfaraylaadvlgvakrshtamfeaihekgsvpiqnvgpdelavfyagyg
vqpdrfvatfngpevekrfqaarayalkvrpvgtptivvngrymvtghdfedtlritdyl
vsreraa

SCOPe Domain Coordinates for d2remb_:

Click to download the PDB-style file with coordinates for d2remb_.
(The format of our PDB-style files is described here.)

Timeline for d2remb_: