Lineage for d2rd5a_ (2rd5 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872996Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1872997Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1873135Family c.73.1.0: automated matches [191466] (1 protein)
    not a true family
  6. 1873136Protein automated matches [190728] (15 species)
    not a true protein
  7. 1873236Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225345] (2 PDB entries)
  8. 1873237Domain d2rd5a_: 2rd5 A: [198335]
    Other proteins in same PDB: d2rd5c_, d2rd5d_
    automated match to d2ap9b_
    complexed with adp, arg, atp, mg, nlg

Details for d2rd5a_

PDB Entry: 2rd5 (more details), 2.51 Å

PDB Description: structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana
PDB Compounds: (A:) Acetylglutamate kinase-like protein

SCOPe Domain Sequences for d2rd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rd5a_ c.73.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dyrveilseslpfiqkfrgktivvkyggaamtspelkssvvsdlvllacvglrpilvhgg
gpdinrylkqlnipaefrdglrvtdattmeivsmvlvgkvnknlvslinaagatavglsg
hdgrlltarpvpnsaqlgfvgevarvdpsvlrplvdygyipviasvaaddsgqayninad
tvagelaaalgaeklilltdvagilenkedpsslikeidikgvkkmiedgkvaggmipkv
kccirslaqgvktasiidgrrqhsllheimsdegagtmitg

SCOPe Domain Coordinates for d2rd5a_:

Click to download the PDB-style file with coordinates for d2rd5a_.
(The format of our PDB-style files is described here.)

Timeline for d2rd5a_: