SCOPe 2.08: Domain d2rd5a_: 2rd5 A:

Lineage for d2rd5a_ (2rd5 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.0: automated matches [191466] (1 protein)
   not a true family

6. Protein automated matches [190728] (15 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225345] (2 PDB entries)

8. Domain d2rd5a_: 2rd5 A: [198335]
   Other proteins in same PDB: d2rd5c_, d2rd5d_
   automated match to d2ap9b_
   complexed with adp, arg, atp, mg, nlg

Details for d2rd5a_

PDB Entry: 2rd5, 2.51 Å

PDB Description: structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana

PDB Compounds: (A:) Acetylglutamate kinase-like protein

SCOPe Domain Sequences for d2rd5a_:

Sequence; same for both SEQRES and ATOM records:

>d2rd5a_ c.73.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dyrveilseslpfiqkfrgktivvkyggaamtspelkssvvsdlvllacvglrpilvhgg
gpdinrylkqlnipaefrdglrvtdattmeivsmvlvgkvnknlvslinaagatavglsg
hdgrlltarpvpnsaqlgfvgevarvdpsvlrplvdygyipviasvaaddsgqayninad
tvagelaaalgaeklilltdvagilenkedpsslikeidikgvkkmiedgkvaggmipkv
kccirslaqgvktasiidgrrqhsllheimsdegagtmitg

Timeline for d2rd5a_:

• d2rd5a_ first appeared in SCOPe 2.03
  
• d2rd5a_ appears in SCOPe 2.07